| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50544190 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1991863 (CHEMBL4625598) |
|---|
| IC50 | 7000±n/a nM |
|---|
| Citation |  Kronenberger, T; Ferreira, GM; de Souza, ADF; da Silva Santos, S; Poso, A; Ribeiro, JA; Tavares, MT; Pavan, FR; Trossini, GHG; Dias, MVB; Parise-Filho, R Design, synthesis and biological activity of novel substituted 3-benzoic acid derivatives as MtDHFR inhibitors. Bioorg Med Chem28:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MYCTU | dfrA | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17872.62 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_102873 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MTMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLP
GRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIG
LPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
|
|
|
|---|
| BDBM50544190 |
|---|
| n/a |
|---|
| Name | BDBM50544190 |
|---|
| Synonyms: | CHEMBL4642912 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H13NO2 |
|---|
| Mol. Mass. | 227.2585 |
|---|
| SMILES | OC(=O)c1cccc(CNc2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
