Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50101830 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158304 |
---|
Ki | 0.740000±n/a nM |
---|
Citation | Tani, K; Naganawa, A; Ishida, A; Egashira, H; Sagawa, K; Harada, H; Ogawa, M; Maruyama, T; Ohuchida, S; Nakai, H; Kondo, K; Toda, M Design and synthesis of a highly selective EP2-receptor agonist. Bioorg Med Chem Lett11:2025-8 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50101830 |
---|
n/a |
---|
Name | BDBM50101830 |
Synonyms: | (Z)-7-{(1R,2R,3R,5R)-5-Chloro-2-[(E)-(S)-4-(1-ethyl-cyclobutyl)-4-hydroxy-but-1-enyl]-3-hydroxy-cyclopentyl}-hept-5-enoic acid | CHEMBL64246 |
Type | Small organic molecule |
Emp. Form. | C22H35ClO4 |
Mol. Mass. | 398.964 |
SMILES | CCC1(CCC1)[C@@H](O)C\C=C\[C@H]1[C@H](O)C[C@@H](Cl)[C@@H]1C\C=C/CCCC(O)=O |
Structure |
|