Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2Y purinoceptor 1
LigandBDBM50085328
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147893
IC50 1600±n/a nM
Citation Kim HSBarak DHarden TKBoyer JLJacobson KA Acyclic and cyclopropyl analogues of adenosine bisphosphate antagonists of the P2Y1 receptor: structure-activity relationships and receptor docking. J Med Chem 44:3092-108 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
P2Y purinoceptor 1
Name:P2Y purinoceptor 1
Synonyms:n/a
Type:n/a
Mol. Mass.:41199.64
Organism:Meleagris gallopavo
Description:n/a
Residue:362
Sequence:
MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV
AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF
HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG
TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN
SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG
LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT
SL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085328
n/a
NameBDBM50085328
Synonyms:CHEMBL432028 | Phosphoric acid mono-[4-(6-methylamino-purin-9-yl)-2-phosphonooxymethyl-butyl] ester
TypeSmall organic molecule
Emp. Form.C11H19N5O8P2
Mol. Mass.411.2448
SMILESCNc1ncnc2n(CCC(COP(O)(O)=O)COP(O)(O)=O)cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: