| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glutamyl-tRNA(Gln) amidotransferase subunit C |
|---|
| Ligand | BDBM50104413 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_72011 |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Decicco, CP; Nelson, DJ; Luo, Y; Shen, L; Horiuchi, KY; Amsler, KM; Foster, LA; Spitz, SM; Merrill, JJ; Sizemore, CF; Rogers, KC; Copeland, RA; Harpel, MR Glutamyl-gamma-boronate inhibitors of bacterial Glu-tRNA(Gln) amidotransferase. Bioorg Med Chem Lett11:2561-4 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glutamyl-tRNA(Gln) amidotransferase subunit C |
|---|
| Name: | Glutamyl-tRNA(Gln) amidotransferase subunit C |
|---|
| Synonyms: | GATC_STRP1 | gatC |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11062.35 |
|---|
| Organism: | Streptococcus pyogenes serotype M1 |
|---|
| Description: | ChEMBL_72840 |
|---|
| Residue: | 100 |
|---|
| Sequence: | MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN
VMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA
|
|
|
|---|
| BDBM50104413 |
|---|
| n/a |
|---|
| Name | BDBM50104413 |
|---|
| Synonyms: | CHEMBL87796 | Glutamyl-gamma-boronate analogue |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C4H10BNO4 |
|---|
| Mol. Mass. | 146.938 |
|---|
| SMILES | N[C@@H](CCB(O)O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
