Reaction Details |
| Report a problem with these data |
Target | Glutamyl-tRNA(Gln) amidotransferase subunit C |
---|
Ligand | BDBM50104415 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_72011 |
---|
IC50 | 70.0±n/a nM |
---|
Citation | Decicco, CP; Nelson, DJ; Luo, Y; Shen, L; Horiuchi, KY; Amsler, KM; Foster, LA; Spitz, SM; Merrill, JJ; Sizemore, CF; Rogers, KC; Copeland, RA; Harpel, MR Glutamyl-gamma-boronate inhibitors of bacterial Glu-tRNA(Gln) amidotransferase. Bioorg Med Chem Lett11:2561-4 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glutamyl-tRNA(Gln) amidotransferase subunit C |
---|
Name: | Glutamyl-tRNA(Gln) amidotransferase subunit C |
Synonyms: | GATC_STRP1 | gatC |
Type: | PROTEIN |
Mol. Mass.: | 11062.35 |
Organism: | Streptococcus pyogenes serotype M1 |
Description: | ChEMBL_72840 |
Residue: | 100 |
Sequence: | MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN
VMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA
|
|
|
BDBM50104415 |
---|
n/a |
---|
Name | BDBM50104415 |
Synonyms: | (S)-2-Amino-4-((1R,5S)-5,9,9-trimethyl-2,4-dioxa-3-bora-tricyclo[6.1.1.0*1,5*]dec-3-yl)-butyric acid methyl ester | CHEMBL85646 |
Type | Small organic molecule |
Emp. Form. | C15H26BNO4 |
Mol. Mass. | 295.182 |
SMILES | COC(=O)[C@@H](N)CCB1O[C@@]23CC(CC[C@]2(C)O1)C3(C)C |
Structure |
|