Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADAM17
LigandBDBM50104973
Substrate/Competitorn/a
Meas. Tech.ChEMBL_206141
Ki 1.7±n/a nM
Citation Xue CBHe XCorbett RLRoderick JWasserman ZRLiu RQJaffee BDCovington MBQian MTrzaskos JMNewton RCMagolda RLWexler RRDecicco CP Discovery of macrocyclic hydroxamic acids containing biphenylmethyl derivatives at P1', a series of selective TNF-alpha converting enzyme inhibitors with potent cellular activity in the inhibition of TNF-alpha release. J Med Chem 44:3351-4 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
ADAM17
Name:ADAM17
Synonyms:A disintegrin and metalloproteinase domain 17 | ADAM 17 | Snake venom-like protease | TNF-alpha-Converting Enzyme
Type:Metalloprotease
Mol. Mass.:12197.99
Organism:Sus scrofa (pig)
Description:Partially purified TACE was obtained from porcine spleen.
Residue:112
Sequence:
MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104973
n/a
NameBDBM50104973
Synonyms:2,10-Dioxo-11-(2'-trifluoromethyl-biphenyl-4-ylmethyl)-1-oxa-3,9-diaza-cyclopentadecane-8,12-dicarboxylic acid 12-hydroxyamide 8-[(2-oxo-2-piperazin-1-yl-ethyl)-amide] | CHEMBL431680
TypeSmall organic molecule
Emp. Form.C34H43F3N6O7
Mol. Mass.704.7364
SMILESONC(=O)[C@H]1CCCOC(=O)NCCCC[C@H](NC(=O)[C@@H]1Cc1ccc(cc1)-c1ccccc1C(F)(F)F)C(=O)NCC(=O)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: