Reaction Details |
| Report a problem with these data |
Target | Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Ligand | BDBM50104973 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_206141 (CHEMBL814098) |
---|
Ki | 1.7±n/a nM |
---|
Citation | Xue, CB; He, X; Corbett, RL; Roderick, J; Wasserman, ZR; Liu, RQ; Jaffee, BD; Covington, MB; Qian, M; Trzaskos, JM; Newton, RC; Magolda, RL; Wexler, RR; Decicco, CP Discovery of macrocyclic hydroxamic acids containing biphenylmethyl derivatives at P1', a series of selective TNF-alpha converting enzyme inhibitors with potent cellular activity in the inhibition of TNF-alpha release. J Med Chem44:3351-4 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
Type: | Metalloprotease |
Mol. Mass.: | 12197.99 |
Organism: | Sus scrofa (pig) |
Description: | Partially purified TACE was obtained from porcine spleen. |
Residue: | 112 |
Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
BDBM50104973 |
---|
n/a |
---|
Name | BDBM50104973 |
Synonyms: | 2,10-Dioxo-11-(2'-trifluoromethyl-biphenyl-4-ylmethyl)-1-oxa-3,9-diaza-cyclopentadecane-8,12-dicarboxylic acid 12-hydroxyamide 8-[(2-oxo-2-piperazin-1-yl-ethyl)-amide] | CHEMBL431680 |
Type | Small organic molecule |
Emp. Form. | C34H43F3N6O7 |
Mol. Mass. | 704.7364 |
SMILES | ONC(=O)[C@H]1CCCOC(=O)NCCCC[C@H](NC(=O)[C@@H]1Cc1ccc(cc1)-c1ccccc1C(F)(F)F)C(=O)NCC(=O)N1CCNCC1 |
Structure |
|