| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrilysin |
|---|
| Ligand | BDBM50104974 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_105054 (CHEMBL711568) |
|---|
| Ki | 1336±n/a nM |
|---|
| Citation |  Xue, CB; He, X; Corbett, RL; Roderick, J; Wasserman, ZR; Liu, RQ; Jaffee, BD; Covington, MB; Qian, M; Trzaskos, JM; Newton, RC; Magolda, RL; Wexler, RR; Decicco, CP Discovery of macrocyclic hydroxamic acids containing biphenylmethyl derivatives at P1', a series of selective TNF-alpha converting enzyme inhibitors with potent cellular activity in the inhibition of TNF-alpha release. J Med Chem44:3351-4 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrilysin |
|---|
| Name: | Matrilysin |
|---|
| Synonyms: | MMP7 | MMP7_HUMAN | MPSL1 | Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7) | Matrix metalloproteinase-7 (MMP7) | PUMP1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29681.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09237 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
|
|
|
|---|
| BDBM50104974 |
|---|
| n/a |
|---|
| Name | BDBM50104974 |
|---|
| Synonyms: | 2,10-Dioxo-11-(2'-trifluoromethyl-biphenyl-4-ylmethyl)-1-oxa-3,9-diaza-cyclopentadecane-8,12-dicarboxylic acid 8-carbamoylmethyl-amide 12-hydroxyamide | CHEMBL115263 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H36F3N5O7 |
|---|
| Mol. Mass. | 635.6313 |
|---|
| SMILES | NC(=O)CNC(=O)[C@@H]1CCCCNC(=O)OCCC[C@@H]([C@@H](Cc2ccc(cc2)-c2ccccc2C(F)(F)F)C(=O)N1)C(=O)NO |
|---|
| Structure | 
|
|---|
Search and Browse
