Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2C18
LigandBDBM50090677
Substrate/Competitorn/a
Meas. Tech.ChEMBL_51520
IC50 60000±n/a nM
Citation Ha-Duong NTDijols SMarques-Soares CMinoletti CDansette PMMansuy D Synthesis of sulfaphenazole derivatives and their use as inhibitors and tools for comparing the active sites of human liver cytochromes P450 of the 2C subfamily. J Med Chem 44:3622-31 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2C18
Name:Cytochrome P450 2C18
Synonyms:CYPIIC18 | P450-6B/29C
Type:PROTEIN
Mol. Mass.:55714.53
Organism:Homo sapiens (Human)
Description:ChEMBL_51520
Residue:490
Sequence:
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKV
YGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRW
KEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
VIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYI
KSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE
TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVP
PLYQLCFIPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090677
n/a
NameBDBM50090677
Synonyms:4-Amino-N-(2-phenyl-2H-pyrazol-3-yl)-benzenesulfonamide | 4-amino-N-(1-phenyl-1H-pyrazol-5-yl)benzenesulfonamide | CHEMBL1109 | SULFAPHENAZOLE | Sulfabid | Sulphaphenazole | US9180183, Sulfaphenazole
TypeSmall organic molecule
Emp. Form.C15H14N4O2S
Mol. Mass.314.362
SMILESNc1ccc(cc1)S(=O)(=O)Nc1ccnn1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: