| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Insulin-like growth factor-binding protein 6 |
|---|
| Ligand | BDBM50106431 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90545 (CHEMBL700615) |
|---|
| Ki | 24±n/a nM |
|---|
| Citation |  Chen, C; Zhu, YF; Liu, XJ; Lu, ZX; Xie, Q; Ling, N Discovery of a series of nonpeptide small molecules that inhibit the binding of insulin-like growth factor (IGF) to IGF-binding proteins. J Med Chem44:4001-10 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Insulin-like growth factor-binding protein 6 |
|---|
| Name: | Insulin-like growth factor-binding protein 6 |
|---|
| Synonyms: | IBP-6 | IBP6 | IBP6_HUMAN | IGF-binding protein 6 | IGFBP-6 | IGFBP6 | Insulin-like growth factor binding protein 6 | Insulin-like growth factor-binding protein 6 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25327.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_90545 |
|---|
| Residue: | 240 |
|---|
| Sequence: | MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
|
|
|
|---|
| BDBM50106431 |
|---|
| n/a |
|---|
| Name | BDBM50106431 |
|---|
| Synonyms: | 1-(3,4-Dihydroxy-benzoyl)-6,7-dihydroxy-isoquinoline-3-carboxylic acid | CHEMBL292700 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H11NO7 |
|---|
| Mol. Mass. | 341.2717 |
|---|
| SMILES | OC(=O)c1cc2cc(O)c(O)cc2c(n1)C(=O)c1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
