Reaction Details |
| Report a problem with these data |
Target | Methylated-DNA--protein-cysteine methyltransferase |
---|
Ligand | BDBM50106517 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_103719 (CHEMBL712287) |
---|
IC50 | 9.0±n/a nM |
---|
Citation | Reinhard, J; Hull, WE; von der Lieth, CW; Eichhorn, U; Kliem, HC; Kaina, B; Wiessler, M Monosaccharide-linked inhibitors of O(6)-methylguanine-DNA methyltransferase (MGMT): synthesis, molecular modeling, and structure-activity relationships. J Med Chem44:4050-61 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methylated-DNA--protein-cysteine methyltransferase |
---|
Name: | Methylated-DNA--protein-cysteine methyltransferase |
Synonyms: | 6-O-methylguanine-DNA methyltransferase | MGMT | MGMT_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 21651.27 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_144711 |
Residue: | 207 |
Sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
|
|
|
BDBM50106517 |
---|
n/a |
---|
Name | BDBM50106517 |
Synonyms: | 6-(4-Bromo-thiophen-2-ylmethoxy)-9H-purin-2-ylamine | CHEMBL339133 |
Type | Small organic molecule |
Emp. Form. | C10H8BrN5OS |
Mol. Mass. | 326.172 |
SMILES | Nc1nc(OCc2cc(Br)cs2)c2[nH]cnc2n1 |
Structure |
|