| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50064946 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2027128 (CHEMBL4681286) |
|---|
| Ki | 2.9±n/a nM |
|---|
| Citation |  Olivieri, M; Amata, E; Vinciguerra, S; Fiorito, J; Giurdanella, G; Drago, F; Caporarello, N; Prezzavento, O; Arena, E; Salerno, L; Rescifina, A; Lupo, G; Anfuso, CD; Marrazzo, A Antiangiogenic Effect of (±)-Haloperidol Metabolite II Valproate Ester [(±)-MRJF22] in Human Microvascular Retinal Endothelial Cells. J Med Chem59:9960-9966 (2016) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50064946 |
|---|
| n/a |
|---|
| Name | BDBM50064946 |
|---|
| Synonyms: | 4-(4-Chloro-phenyl)-1-[4-(4-fluoro-phenyl)-4-hydroxy-butyl]-piperidin-4-ol | CHEMBL1036 | Hydroxyhaloperidol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25ClFNO2 |
|---|
| Mol. Mass. | 377.88 |
|---|
| SMILES | OC(CCCN1CCC(O)(CC1)c1ccc(Cl)cc1)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
