| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Programmed cell death 1 ligand 1 |
|---|
| Ligand | BDBM50552495 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2034715 (CHEMBL4688873) |
|---|
| IC50 | 19200±n/a nM |
|---|
| Citation |  Orafaie, A; Sadeghian, H; Bahrami, AR; Rafatpanah, H; Matin, MM Design, synthesis and evaluation of PD-L1 peptide antagonists as new anticancer agents for immunotherapy. Bioorg Med Chem30:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Programmed cell death 1 ligand 1 |
|---|
| Name: | Programmed cell death 1 ligand 1 |
|---|
| Synonyms: | B7 homolog 1 | B7-H1 | B7H1 | B7H1 | CD274 | CD_antigen=CD274 | PD-L1 | PD1L1_HUMAN | PDCD1 ligand 1 | PDCD1L1 | PDCD1LG1 | PDL1 | Programmed cell death 1 ligand 1 | Programmed death ligand 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33278.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109807 |
|---|
| Residue: | 290 |
|---|
| Sequence: | MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
|
|
|
|---|
| BDBM50552495 |
|---|
| n/a |
|---|
| Name | BDBM50552495 |
|---|
| Synonyms: | CHEMBL4798338 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C65H114N18O21S |
|---|
| Mol. Mass. | 1515.774 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
