Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50112201
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105404
Ki 194±n/a nM
Citation Leclerc VYous SDelagrange PBoutin JARenard PLesieur D Synthesis of nitroindole derivatives with high affinity and selectivity for melatoninergic binding sites MT(3). J Med Chem 45:1853-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50112201
n/a
NameBDBM50112201
Synonyms:CHEMBL53622 | N-(2-(5-methoxy-1-methyl-4-nitro-1H-indol-3-yl)ethyl)acetamide | N-[2-(5-Methoxy-1-methyl-4-nitro-1H-indol-3-yl)-ethyl]-acetamide
TypeSmall organic molecule
Emp. Form.C14H17N3O4
Mol. Mass.291.3025
SMILESCOc1ccc2n(C)cc(CCNC(C)=O)c2c1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: