| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 receptor antagonist protein |
|---|
| Ligand | BDBM50553095 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2045077 (CHEMBL4699776) |
|---|
| Ki | 674±n/a nM |
|---|
| Citation |  Barlow, N; Vanga, SR; Sävmarker, J; Sandström, A; Burns, P; Hallberg, A; Åqvist, J; Gutiérrez-de-Terán, H; Hallberg, M; Larhed, M; Chai, SY; Thompson, PE Macrocyclic peptidomimetics as inhibitors of insulin-regulated aminopeptidase (IRAP). RSC Med Chem11:234-244 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-1 receptor antagonist protein |
|---|
| Name: | Interleukin-1 receptor antagonist protein |
|---|
| Synonyms: | ICIL-1RA | IL-1RN | IL-1ra | IL1 inhibitor | IL1F3 | IL1RA | IL1RA_HUMAN | IL1RN | INN=Anakinra | IRAP | Interleukin-1 receptor antagonist protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 20053.78 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_118941 |
|---|
| Residue: | 177 |
|---|
| Sequence: | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
|
|
|
|---|
| BDBM50553095 |
|---|
| n/a |
|---|
| Name | BDBM50553095 |
|---|
| Synonyms: | CHEMBL4745618 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H35N5O7 |
|---|
| Mol. Mass. | 553.6068 |
|---|
| SMILES | N[C@H]1CCC(=O)NCC[C@H](NC(=O)C[C@H](Cc2ccc(O)cc2)NC1=O)C(=O)NCc1ccccc1CC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
