Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM10847 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_29145 (CHEMBL638690) |
---|
Ki | 6920±n/a nM |
---|
Citation | Kim, SA; Marshall, MA; Melman, N; Kim, HS; Müller, CE; Linden, J; Jacobson, KA Structure-activity relationships at human and rat A2B adenosine receptors of xanthine derivatives substituted at the 1-, 3-, 7-, and 8-positions. J Med Chem45:2131-8 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
Type: | Protein |
Mol. Mass.: | 36704.13 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 326 |
Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
BDBM10847 |
---|
n/a |
---|
Name | BDBM10847 |
Synonyms: | 1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 1,3-dimethyl-7H-purine-2,6-dione | Afonilum | Aminophyllin | Aminophylline | CHEMBL190 | Cardophyllin | Euphylline | Theophy-lline | Theophylline | Theophylline (1,3-dimethylxanthine) |
Type | Small organic molecule |
Emp. Form. | C7H8N4O2 |
Mol. Mass. | 180.164 |
SMILES | Cn1c2nc[nH]c2c(=O)n(C)c1=O |
Structure |
|