| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM32020 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2045853 (CHEMBL4700552) |
|---|
| IC50 | 220±n/a nM |
|---|
| Citation |  Oliveri, V Toward the discovery and development of effective modulators of ?-synuclein amyloid aggregation. Eur J Med Chem167:10-36 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM32020 |
|---|
| n/a |
|---|
| Name | BDBM32020 |
|---|
| Synonyms: | 4-[4-(3,4-dihydroxyphenyl)-2,3-dimethyl-butyl]pyrocatechol | 4-[4-(3,4-dihydroxyphenyl)-2,3-dimethylbutyl]benzene-1,2-diol | 4-[4-[3,4-bis(oxidanyl)phenyl]-2,3-dimethyl-butyl]benzene-1,2-diol | BDBM166684 | CHEMBL52 | LOX inhibitor, N/A | MLS000069451 | NORDIHYDROGUAIARETIC ACID | Nordihydroguaiaretic acid (NDGA) | SMR000059049 | US10857082, Compound 2.18 | cid_4534 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22O4 |
|---|
| Mol. Mass. | 302.3649 |
|---|
| SMILES | CC(Cc1ccc(O)c(O)c1)C(C)Cc1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
