Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-dependent kinase 1
LigandBDBM50113694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_50316
IC50 1300000±n/a nM
Citation Naumann TMatter H Structural classification of protein kinases using 3D molecular interaction field analysis of their ligand binding sites: target family landscapes. J Med Chem 45:2366-78 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cyclin-dependent kinase 1
Name:Cyclin-dependent kinase 1/G1/S-specific cyclin-D1
Synonyms:Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | p34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:34101.08
Organism:Homo sapiens (Human)
Description:P06493
Residue:297
Sequence:
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50113694
n/a
NameBDBM50113694
Synonyms:3-[9-Isopropyl-6-(4-methoxy-benzylamino)-9H-purin-2-ylamino]-propane-1,2-diol | CHEMBL312530
TypeSmall organic molecule
Emp. Form.C19H26N6O3
Mol. Mass.386.4481
SMILESCOc1ccc(CNc2nc(NCC(O)CO)nc3n(cnc23)C(C)C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: