| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50553887 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2047515 (CHEMBL4702214) |
|---|
| Kd | 16±n/a nM |
|---|
| Citation |  Xiao, Z; Chen, D; Song, S; van der Vlag, R; van der Wouden, PE; van Merkerk, R; Cool, RH; Hirsch, AKH; Melgert, BN; Quax, WJ; Poelarends, GJ; Dekker, FJ 7-Hydroxycoumarins Are Affinity-Based Fluorescent Probes for Competitive Binding Studies of Macrophage Migration Inhibitory Factor. J Med Chem63:11920-11933 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50553887 |
|---|
| n/a |
|---|
| Name | BDBM50553887 |
|---|
| Synonyms: | CHEMBL4779696 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H14O5 |
|---|
| Mol. Mass. | 358.3436 |
|---|
| SMILES | OC(=O)c1ccc(cc1)-c1ccc(cc1)-c1cc2ccc(O)cc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
