Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuromedin-K receptor
LigandBDBM50116726
Substrate/Competitorn/a
Meas. Tech.ChEBML_209564
Ki 0.500000±n/a nM
Citation Reichard GAGrice CAShih NYSpitler JMajmundar SWang SDPaliwal SAnthes JCPiwinski JJ Preparation of oxime dual NK(1)/NK(2) antagonists with reduced NK(3) affinity. Bioorg Med Chem Lett 12:2355-8 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuromedin-K receptor
Name:Neuromedin-K receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin 3 receptor | Neurokinin B receptor | Neurokinin-3 (NK-3) | Neuromedin-3 receptor (NK-3R) | Neuromedin-3 receptor (NK3) | Neuromedin-K receptor (NK3) | Tachykinin receptor 3 | Tachykinin receptor 3 (NK3)
Type:Enzyme
Mol. Mass.:52221.96
Organism:Homo sapiens (Human)
Description:P29371
Residue:465
Sequence:
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116726
n/a
NameBDBM50116726
Synonyms:3,5-Dichloro-N-{(R)-3-(3,4-dichloro-phenyl)-2-[(Z)-methoxyimino]-5-[4-(2-oxo-3-pyridin-2-yl-tetrahydro-pyrimidin-1-yl)-piperidin-1-yl]-pentyl}-N-methyl-benzamide | CHEMBL76965
TypeSmall organic molecule
Emp. Form.C34H38Cl4N6O3
Mol. Mass.720.516
SMILESCO\N=C(/CN(C)C(=O)c1cc(Cl)cc(Cl)c1)[C@H](CCN1CCC(CC1)N1CCCN(C1=O)c1ccccn1)c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: