Reaction Details |
| Report a problem with these data |
Target | Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Ligand | BDBM50120685 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212588 (CHEMBL811890) |
---|
IC50 | 97±n/a nM |
---|
Citation | Duan, JJ; Chen, L; Wasserman, ZR; Lu, Z; Liu, RQ; Covington, MB; Qian, M; Hardman, KD; Magolda, RL; Newton, RC; Christ, DD; Wexler, RR; Decicco, CP Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. J Med Chem45:4954-7 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
Type: | Metalloprotease |
Mol. Mass.: | 12197.99 |
Organism: | Sus scrofa (pig) |
Description: | Partially purified TACE was obtained from porcine spleen. |
Residue: | 112 |
Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
BDBM50120685 |
---|
n/a |
---|
Name | BDBM50120685 |
Synonyms: | 2-[3-(4-Allyloxy-phenyl)-3-methyl-2-oxo-pyrrolidin-1-yl]-N-hydroxy-propionamide | CHEMBL359424 |
Type | Small organic molecule |
Emp. Form. | C17H22N2O4 |
Mol. Mass. | 318.3676 |
SMILES | C[C@@H](N1CC[C@](C)(C1=O)c1ccc(OCC=C)cc1)C(=O)NO |
Structure |
|