| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM50558857 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2065940 (CHEMBL4721193) |
|---|
| IC50 | 20±n/a nM |
|---|
| Citation |  D de Araujo, A; Lim, J; Wu, KC; Xiang, Y; Good, AC; Skerlj, R; Fairlie, DP Bicyclic Helical Peptides as Dual Inhibitors Selective for Bcl2A1 and Mcl-1 Proteins. J Med Chem61:2962-2972 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 20130.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
|---|
| BDBM50558857 |
|---|
| n/a |
|---|
| Name | BDBM50558857 |
|---|
| Synonyms: | CHEMBL4752520 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C79H124N20O21 |
|---|
| Mol. Mass. | 1689.9513 |
|---|
| SMILES | [H][C@]1(CC(=O)NCCCC[C@]([H])(NC(C)=O)C(=O)NC(CNC(=O)C=C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@]1(C)CCC\C=C\CCC[C@](C)(NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@]([H])(NC1=O)[C@@H](C)CC)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r,t:79| |
|---|
| Structure | 
|
|---|
Search and Browse
