Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50121139
Substrate/Competitorn/a
Meas. Tech.ChEBML_140179
Ki 0.530000±n/a nM
Citation Boyle CDVice SFCampion JChackalamannil SLankin CMMcCombie SWBillard WBinch HCrosby GWilliams MCCoffin VLCox KAGrotz DEDuffy RARuperto VLachowicz JE Enhancement of pharmacokinetic properties and in vivo efficacy of benzylidene ketal M(2) muscarinic receptor antagonists via benzamide modification. Bioorg Med Chem Lett 12:3479-82 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121139
n/a
NameBDBM50121139
Synonyms:(5-Amino-2-chloro-phenyl)-(4-{2-[4-(4-methoxy-benzenesulfonyl)-phenyl]-[1,3]dioxolan-2-yl}-[1,4']bipiperidinyl-1'-yl)-methanone | CHEMBL119131
TypeSmall organic molecule
Emp. Form.C33H38ClN3O6S
Mol. Mass.640.189
SMILESCOc1ccc(cc1)S(=O)(=O)c1ccc(cc1)C1(OCCO1)C1CCN(CC1)C1CCN(CC1)C(=O)c1cc(N)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: