| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytochrome c oxidase subunit 2 |
|---|
| Ligand | BDBM13066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2067170 (CHEMBL4722423) |
|---|
| IC50 | 10050±n/a nM |
|---|
| Citation |  Jan, MS; Ahmad, S; Hussain, F; Ahmad, A; Mahmood, F; Rashid, U; Abid, OU; Ullah, F; Ayaz, M; Sadiq, A Design, synthesis, in-vitro, in-vivo and in-silico studies of pyrrolidine-2,5-dione derivatives as multitarget anti-inflammatory agents. Eur J Med Chem186:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytochrome c oxidase subunit 2 |
|---|
| Name: | Cytochrome c oxidase subunit 2 |
|---|
| Synonyms: | COII | COX2 | COX2_HUMAN | COXII | MT-CO2 | MTCO2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25555.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_530099 |
|---|
| Residue: | 227 |
|---|
| Sequence: | MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
|
|
|
|---|
| BDBM13066 |
|---|
| n/a |
|---|
| Name | BDBM13066 |
|---|
| Synonyms: | 2-{2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid | CHEMBL139 | Diclofenac | US11337935, Compound Diclofenac | US11478464, Compound Diclofenac | US11786535, Compound Diclofenac | {2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11Cl2NO2 |
|---|
| Mol. Mass. | 296.149 |
|---|
| SMILES | OC(=O)Cc1ccccc1Nc1c(Cl)cccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
