| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Insulin-like growth factor-binding protein 5 |
|---|
| Ligand | BDBM50121966 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90410 (CHEMBL698365) |
|---|
| Kd | 2420000±n/a nM |
|---|
| Citation |  Kamionka, M; Rehm, T; Beisel, HG; Lang, K; Engh, RA; Holak, TA In silico and NMR identification of inhibitors of the IGF-I and IGF-binding protein-5 interaction. J Med Chem45:5655-60 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Insulin-like growth factor-binding protein 5 |
|---|
| Name: | Insulin-like growth factor-binding protein 5 |
|---|
| Synonyms: | IBP5 | IBP5_HUMAN | IGFBP5 | Insulin-like growth factor binding protein 5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30581.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_90411 |
|---|
| Residue: | 272 |
|---|
| Sequence: | MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
|
|
|
|---|
| BDBM50121966 |
|---|
| n/a |
|---|
| Name | BDBM50121966 |
|---|
| Synonyms: | 2-(9H-Fluoren-9-ylmethoxycarbonylamino)-3-(4-phosphonooxy-phenyl)-propionic acid | CHEMBL154506 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H22NO8P |
|---|
| Mol. Mass. | 483.4071 |
|---|
| SMILES | OC(=O)[C@@H](Cc1ccc(OP(O)(O)=O)cc1)NC(=O)OCC1c2ccccc2-c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
