Reaction Details |
| Report a problem with these data |
Target | Insulin-like growth factor-binding protein 5 |
---|
Ligand | BDBM50121968 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_90408 (CHEMBL698363) |
---|
Kd | 1088000±n/a nM |
---|
Citation | Kamionka, M; Rehm, T; Beisel, HG; Lang, K; Engh, RA; Holak, TA In silico and NMR identification of inhibitors of the IGF-I and IGF-binding protein-5 interaction. J Med Chem45:5655-60 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Insulin-like growth factor-binding protein 5 |
---|
Name: | Insulin-like growth factor-binding protein 5 |
Synonyms: | IBP5 | IBP5_HUMAN | IGFBP5 | Insulin-like growth factor binding protein 5 |
Type: | PROTEIN |
Mol. Mass.: | 30581.07 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_90411 |
Residue: | 272 |
Sequence: | MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
|
|
|
BDBM50121968 |
---|
n/a |
---|
Name | BDBM50121968 |
Synonyms: | 2-(9H-Fluoren-9-ylmethoxycarbonylamino)-4-methyl-pentanoic acid | CHEMBL152028 |
Type | Small organic molecule |
Emp. Form. | C21H23NO4 |
Mol. Mass. | 353.4116 |
SMILES | CC(C)C[C@@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O |
Structure |
|