| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50122294 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_37636 |
|---|
| IC50 | 0.770000±n/a nM |
|---|
| Citation |  Zhang, MR; Maeda, J; Furutsuka, K; Yoshida, Y; Ogawa, M; Suhara, T; Suzuki, K [18F]FMDAA1106 and [18F]FEDAA1106: two positron-emitter labeled ligands for peripheral benzodiazepine receptor (PBR). Bioorg Med Chem Lett13:201-4 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50122294 |
|---|
| n/a |
|---|
| Name | BDBM50122294 |
|---|
| Synonyms: | CHEMBL292092 | N-(5-fluoro-2-phenoxyphenyl)-N-(2-(2-fluoroethoxy)-5-methoxybenzyl)acetamide | N-[2-(2-Fluoro-ethoxy)-5-methoxy-benzyl]-N-(5-fluoro-2-phenoxy-phenyl)-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23F2NO4 |
|---|
| Mol. Mass. | 427.4405 |
|---|
| SMILES | COc1ccc(OCCF)c(CN(C(C)=O)c2cc(F)ccc2Oc2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
