Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine Nucleoside Phosphorylase (PNP)
LigandBDBM50122724
Substrate/Competitorn/a
Meas. Tech.ChEMBL_162004
Ki 0.06±n/a nM
Citation Evans GBFurneaux RHGainsford GJHanson JCKicska GASauve AASchramm VLTyler PC 8-Aza-immucillins as transition-state analogue inhibitors of purine nucleoside phosphorylase and nucleoside hydrolases. J Med Chem 46:155-60 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purine Nucleoside Phosphorylase (PNP)
Name:Purine nucleoside phosphorylase
Synonyms:Inosine phosphorylase
Type:Enzyme
Mol. Mass.:32035.18
Organism:Bos taurus (bovine)
Description:n/a
Residue:289
Sequence:
MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEST
VPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGL
NPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ
MGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPVSGHTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122724
n/a
NameBDBM50122724
Synonyms:4-Amino-5-(3,4-dihydroxy-5-hydroxymethyl-pyrrolidin-2-yl)-2H-pyrazole-3-carboxylic acid amide | CHEMBL41949
TypeSmall organic molecule
Emp. Form.C9H15N5O4
Mol. Mass.257.2465
SMILESNC(=O)c1[nH]nc(C2N[C@H](CO)[C@H](O)[C@@H]2O)c1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: