| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50124009 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145281 (CHEMBL751217) |
|---|
| Ki | 14±n/a nM |
|---|
| Citation |  Wentland, MP; Ye, Y; Cioffi, CL; Lou, R; Zhou, Q; Xu, G; Duan, W; Dehnhardt, CM; Sun, X; Cohen, DJ; Bidlack, JM Syntheses and opioid receptor binding affinities of 8-amino-2,6-methano-3-benzazocines. J Med Chem46:838-49 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50124009 |
|---|
| n/a |
|---|
| Name | BDBM50124009 |
|---|
| Synonyms: | 6,11-Dimethyl-3-(tetrahydro-furan-2-ylmethyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ylamine | CHEMBL2368317 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H28N2O |
|---|
| Mol. Mass. | 300.4384 |
|---|
| SMILES | [H][C@@]1(CN2CC[C@@]3(C)[C@@H](C)[C@@]2([H])Cc2ccc(N)cc32)CCCO1 |TLB:2:3:8:19.13.12,THB:18:19:8:3.5.4| |
|---|
| Structure | 
|
|---|
Search and Browse
