| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N-formyl peptide receptor 2 |
|---|
| Ligand | BDBM50295523 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2081556 (CHEMBL4737347) |
|---|
| EC50 | 3800±n/a nM |
|---|
| Citation |  Maciuszek, M; Ortega-Gomez, A; Maas, SL; Perretti, M; Merritt, A; Soehnlein, O; Chapman, TM Synthesis and evaluation of novel cyclopentane urea FPR2 agonists and their potential application in the treatment of cardiovascular inflammation. Eur J Med Chem214:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N-formyl peptide receptor 2 |
|---|
| Name: | N-formyl peptide receptor 2 |
|---|
| Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38968.35 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25090 |
|---|
| Residue: | 351 |
|---|
| Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
|---|
| BDBM50295523 |
|---|
| n/a |
|---|
| Name | BDBM50295523 |
|---|
| Synonyms: | CHEMBL562380 | N-(4-Bromophenyl)-2-[5-(4-methoxybenzyl)-3-methyl-6-oxo-6H-pyridazin-1-yl]-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20BrN3O3 |
|---|
| Mol. Mass. | 442.306 |
|---|
| SMILES | COc1ccc(Cc2cc(C)nn(CC(=O)Nc3ccc(Br)cc3)c2=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
