Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 11 |
---|
Ligand | BDBM50127769 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_92724 |
---|
EC50 | 154±n/a nM |
---|
Citation | Turner, SC; Carroll, WA; White, TK; Brune, ME; Buckner, SA; Gopalakrishnan, M; Fabiyi, A; Coghlan, MJ; Scott, VE; Castle, NA; Daza, AV; Milicic, I; Sullivan, JP Structure-activity relationship of a novel class of naphthyl amide KATP channel openers. Bioorg Med Chem Lett13:1741-4 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 11 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 11 |
Synonyms: | ATP-sensitive inward rectifier potassium channel 11 | IKATP | Inward rectifier K(+) channel Kir6.2 | KCJ11_HUMAN | KCNJ11 | Potassium channel, inwardly rectifying subfamily J member 11 | Potassium channel, inwardly rectifying, subfamily J, member 11 | Sulfonylurea receptor 1, Kir6.2 | Sulfonylurea receptor 2, Kir6.2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 43549.41 |
Organism: | Homo sapiens (Human) |
Description: | Potassium channel (ATP modulatory) 0 0::Q14654 |
Residue: | 390 |
Sequence: | MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
|
|
|
BDBM50127769 |
---|
n/a |
---|
Name | BDBM50127769 |
Synonyms: | 4-Iodo-N-[2-(2,2,2-trifluoro-1-hydroxy-1-trifluoromethyl-ethyl)-naphthalen-1-yl]-benzamide | CHEMBL51460 |
Type | Small organic molecule |
Emp. Form. | C20H12F6INO2 |
Mol. Mass. | 539.2097 |
SMILES | OC(c1ccc2ccccc2c1NC(=O)c1ccc(I)cc1)(C(F)(F)F)C(F)(F)F |
Structure |
|