| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Insulin-like growth factor-binding protein 3 |
|---|
| Ligand | BDBM50128459 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_90403 |
|---|
| Ki | 8±n/a nM |
|---|
| Citation |  Zhu, YF; Wang, XC; Connors, P; Wilcoxen, K; Gao, Y; Gross, R; Strack, N; Gross, T; McCarthy, JR; Xie, Q; Ling, N; Chen, C Quinoline-carboxylic acids are potent inhibitors that inhibit the binding of insulin-like growth factor (IGF) to IGF-binding proteins. Bioorg Med Chem Lett13:1931-4 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Insulin-like growth factor-binding protein 3 |
|---|
| Name: | Insulin-like growth factor-binding protein 3 |
|---|
| Synonyms: | IBP3 | IBP3_HUMAN | IGFBP3 | Insulin-like growth factor binding protein 3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31690.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_90404 |
|---|
| Residue: | 291 |
|---|
| Sequence: | MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
|
|
|
|---|
| BDBM50128459 |
|---|
| n/a |
|---|
| Name | BDBM50128459 |
|---|
| Synonyms: | 4-(3,4-Dihydroxy-benzyl)-6,7-dihydroxy-quinoline-2-carboxylic acid | CHEMBL56978 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13NO6 |
|---|
| Mol. Mass. | 327.2882 |
|---|
| SMILES | OC(=O)c1cc(Cc2ccc(O)c(O)c2)c2cc(O)c(O)cc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
