Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM50131197 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_44674 |
---|
IC50 | 450±n/a nM |
---|
Citation | Baxter, A; Bennion, C; Bent, J; Boden, K; Brough, S; Cooper, A; Kinchin, E; Kindon, N; McInally, T; Mortimore, M; Roberts, B; Unitt, J Hit-to-lead studies: the discovery of potent, orally bioavailable triazolethiol CXCR2 receptor antagonists. Bioorg Med Chem Lett13:2625-8 (2003) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM50131197 |
---|
n/a |
---|
Name | BDBM50131197 |
Synonyms: | 5-(2,4-Dichloro-phenyl)-2-phenethyl-2H-[1,2,4]triazole-3-thiol | CHEMBL85117 |
Type | Small organic molecule |
Emp. Form. | C16H13Cl2N3S |
Mol. Mass. | 350.266 |
SMILES | Clc1ccc(-c2nn(CCc3ccccc3)c(=S)[nH]2)c(Cl)c1 |
Structure |
|