Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTubulin
LigandBDBM50134461
Substrate/Competitorn/a
Meas. Tech.ChEBML_211866
IC50>50000±n/a nM
Citation Lawrence NJRennison DMcGown ATHadfield JA The total synthesis of an aurone isolated from Uvaria hamiltonii: aurones and flavones as anticancer agents. Bioorg Med Chem Lett 13:3759-63 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tubulin
Name:Tubulin
Synonyms:Tubulin alpha chain | Tubulin alpha-1A chain
Type:Protein
Mol. Mass.:50049.25
Organism:Sus scrofa (Pig)
Description:P02550
Residue:451
Sequence:
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134461
n/a
NameBDBM50134461
Synonyms:2-(3-Hydroxy-4-methoxy-phenyl)-5,6,7-trimethoxy-chromen-4-one | CHEMBL124885 | eupatorin-5-methylether
TypeSmall organic molecule
Emp. Form.C19H18O7
Mol. Mass.358.342
SMILESCOc1ccc(cc1O)-c1cc(=O)c2c(OC)c(OC)c(OC)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: