| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-15 |
|---|
| Ligand | BDBM50571041 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2113695 (CHEMBL4822545) |
|---|
| IC50 | 6000±n/a nM |
|---|
| Citation |  Smadja, J; Quéméner, A; Maillasson, M; Sicard, B; Leray, A; Arzel, L; Lebreton, J; Mortier, E; Dubreuil, D; Mathé-Allainmat, M Rational modification, synthesis and biological evaluation of N-substituted phthalazinone derivatives designed to target interleukine-15 protein. Bioorg Med Chem39:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-15 |
|---|
| Name: | Interleukin-15 |
|---|
| Synonyms: | IL-15 | IL15_MOUSE | Il15 | Interleukin-15 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18588.73 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_120403 |
|---|
| Residue: | 162 |
|---|
| Sequence: | MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKI
ESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANS
TLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
|
|
|
|---|
| BDBM50571041 |
|---|
| n/a |
|---|
| Name | BDBM50571041 |
|---|
| Synonyms: | CHEMBL4864820 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H20Cl2N6O3S |
|---|
| Mol. Mass. | 531.414 |
|---|
| SMILES | Cn1nc(Cc2nnc(SCC(=O)Nc3ccc(Cl)cc3Cl)n2CCC=O)c2ccccc2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
