| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Ligand | BDBM50136263 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_212585 |
|---|
| IC50 | 0.410000±n/a nM |
|---|
| Citation |  Xue, CB; He, X; Roderick, J; Corbett, RL; Duan, JJ; Liu, RQ; Covington, MB; Qian, M; Ribadeneira, MD; Vaddi, K; Christ, DD; Newton, RC; Trzaskos, JM; Magolda, RL; Wexler, RR; Decicco, CP Rational design, synthesis and structure-activity relationships of a cyclic succinate series of TNF-alpha converting enzyme inhibitors. Part 2: lead optimization. Bioorg Med Chem Lett13:4299-304 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
|---|
| Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
|---|
| Type: | Metalloprotease |
|---|
| Mol. Mass.: | 12197.99 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Partially purified TACE was obtained from porcine spleen. |
|---|
| Residue: | 112 |
|---|
| Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
|---|
| BDBM50136263 |
|---|
| n/a |
|---|
| Name | BDBM50136263 |
|---|
| Synonyms: | (3R,4S)-Piperidine-1,3,4-tricarboxylic acid 1-tert-butylamide 3-hydroxyamide 4-{[4-(2-methyl-quinolin-4-ylmethoxy)-phenyl]-amide} | CHEMBL137013 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H35N5O5 |
|---|
| Mol. Mass. | 533.6187 |
|---|
| SMILES | Cc1cc(COc2ccc(NC(=O)[C@H]3CCN(C[C@@H]3C(=O)NO)C(=O)NC(C)(C)C)cc2)c2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
