| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Holo-[acyl-carrier-protein] synthase |
|---|
| Ligand | BDBM50137228 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_88040 |
|---|
| IC50 | >20000±n/a nM |
|---|
| Citation |  Gilbert, AM; Kirisits, M; Toy, P; Nunn, DS; Failli, A; Dushin, EG; Novikova, E; Petersen, PJ; Joseph-McCarthy, D; McFadyen, I; Fritz, CC Anthranilate 4H-oxazol-5-ones: novel small molecule antibacterial acyl carrier protein synthase (AcpS) inhibitors. Bioorg Med Chem Lett14:37-41 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Holo-[acyl-carrier-protein] synthase |
|---|
| Name: | Holo-[acyl-carrier-protein] synthase |
|---|
| Synonyms: | ACPS_BACSU | Holo-[acyl-carrieir-protein] synthase | acpS | ydcB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13724.66 |
|---|
| Organism: | Bacillus subtilis |
|---|
| Description: | ChEMBL_326222 |
|---|
| Residue: | 121 |
|---|
| Sequence: | MIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAF
SKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAAQVVIERLS
S
|
|
|
|---|
| BDBM50137228 |
|---|
| n/a |
|---|
| Name | BDBM50137228 |
|---|
| Synonyms: | 5-Fluoro-2-{[2-(4-methoxy-phenyl)-5-oxo-oxazol-(4E)-ylidenemethyl]-amino}-benzoic acid | CHEMBL133468 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H13FN2O5 |
|---|
| Mol. Mass. | 356.3046 |
|---|
| SMILES | COc1ccc(cc1)-c1nc(\C=N\c2ccc(F)cc2C(O)=O)c(O)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
