| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50137333 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_154314 |
|---|
| IC50 | 2±n/a nM |
|---|
| Citation |  East, SP; Beckett, RP; Brookings, DC; Clements, JM; Doel, S; Keavey, K; Pain, G; Smith, HK; Thomas, W; Thompson, AJ; Todd, RS; Whittaker, M Peptide deformylase inhibitors with activity against respiratory tract pathogens. Bioorg Med Chem Lett14:59-62 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 16901.39 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
|---|
| BDBM50137333 |
|---|
| n/a |
|---|
| Name | BDBM50137333 |
|---|
| Synonyms: | (R)-2-Cyclopentylmethyl-N-{(S)-1-[3-fluoro-4-((S)-2-hydroxymethyl-pyrrolidin-1-yl)-benzoyl]-2,2-dimethyl-propyl}-3-(formyl-hydroxy-amino)-propionamide | CHEMBL348314 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H40FN3O5 |
|---|
| Mol. Mass. | 505.622 |
|---|
| SMILES | CC(C)(C)[C@H](NC(=O)[C@H](CC1CCCC1)CN(O)C=O)C(=O)c1ccc(N2CCC[C@H]2CO)c(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
