| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Calcium and integrin-binding protein 1 |
|---|
| Ligand | BDBM50572341 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2116701 (CHEMBL4825642) |
|---|
| IC50 | 54±n/a nM |
|---|
| Citation |  Haberman, VA; Fleming, SR; Leisner, TM; Puhl, AC; Feng, E; Xie, L; Chen, X; Goto, Y; Suga, H; Parise, LV; Kireev, D; Pearce, KH; Bowers, AA Discovery and Development of Cyclic Peptide Inhibitors of CIB1. ACS Med Chem Lett12:1832-1839 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Calcium and integrin-binding protein 1 |
|---|
| Name: | Calcium and integrin-binding protein 1 |
|---|
| Synonyms: | CIB | CIB1 | CIB1_HUMAN | Calcium and integrin-binding protein 1 | Calcium- and integrin-binding protein | Calmyrin | KIP | PRKDCIP |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21691.54 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_120467 |
|---|
| Residue: | 191 |
|---|
| Sequence: | MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
|
|
|
|---|
| BDBM50572341 |
|---|
| n/a |
|---|
| Name | BDBM50572341 |
|---|
| Synonyms: | CHEMBL4874071 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C76H98N16O16S |
|---|
| Mol. Mass. | 1523.754 |
|---|
| SMILES | CC[C@H](C)[C@@H]1NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)N(C)C(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@@H]2CCCN2C(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)N(C)C(=O)[C@H](Cc2ccc(O)cc2)NC(=O)CSC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CC(N)=O)NC1=O)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
