Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50138001 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145149 (CHEMBL755953) |
---|
Ki | 37±n/a nM |
---|
Citation | Zhang, A; Xiong, W; Bidlack, JM; Hilbert, JE; Knapp, BI; Wentland, MP; Neumeyer, JL 10-Ketomorphinan and 3-substituted-3-desoxymorphinan analogues as mixed kappa and micro opioid ligands: synthesis and biological evaluation of their binding affinity at opioid receptors. J Med Chem47:165-74 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50138001 |
---|
n/a |
---|
Name | BDBM50138001 |
Synonyms: | 3-Cyano-N-cyclobutylmethylmorphinan | CHEMBL48157 |
Type | Small organic molecule |
Emp. Form. | C22H28N2 |
Mol. Mass. | 320.4711 |
SMILES | N#Cc1ccc2C[C@@H]3[C@@H]4CCCC[C@]4(CCN3CC3CCC3)c2c1 |
Structure |
|