| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50140282 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_28895 |
|---|
| IC50 | 890±n/a nM |
|---|
| Citation |  Kurata, H; Suzuki, S; Ohhata, Y; Ikeda, T; Hasegawa, T; Kitayama, K; Inaba, T; Kono, K; Kohama, T A novel class of apical sodium-dependent bile acid transporter inhibitors: the amphiphilic 4-oxo-1-phenyl-1,4-dihydroquinoline derivatives. Bioorg Med Chem Lett14:1183-6 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37714.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | SLC10A2 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
|---|
| BDBM50140282 |
|---|
| n/a |
|---|
| Name | BDBM50140282 |
|---|
| Synonyms: | 1-{4-[4-((4R,5R)-3,3-Dibutyl-7-dimethylamino-4-hydroxy-1,1-dioxo-2,3,4,5-tetrahydro-1H-1lambda*6*-benzo[b]thiepin-5-yl)-phenoxymethyl]-benzyl}-4-aza-1-azonia-bicyclo[2.2.2]octane; chloride | CHEMBL17879 | CHEMBL363392 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H56N3O4S |
|---|
| Mol. Mass. | 674.955 |
|---|
| SMILES | CCCCC1(CCCC)CS(=O)(=O)c2ccc(cc2[C@H]([C@H]1O)c1ccc(OCc2ccc(C[N+]34CCN(CC3)CC4)cc2)cc1)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
