| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Ligand | BDBM50142324 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_207132 |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Lau, CK; Bayly, CI; Gauthier, JY; Li, CS; Therien, M; Asante-Appiah, E; Cromlish, W; Boie, Y; Forghani, F; Desmarais, S; Wang, Q; Skorey, K; Waddleton, D; Payette, P; Ramachandran, C; Kennedy, BP; Scapin, G Structure based design of a series of potent and selective non peptidic PTP-1B inhibitors. Bioorg Med Chem Lett14:1043-8 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Synonyms: | PTN2_HUMAN | PTPN2 | PTPT | T-cell protein tyrosine phosphatase (TCPTP) | T-cell protein-tyrosine phosphatase | TC-PTP | TCPTP | Tyrosine-protein phosphatase non-receptor type 2 | Tyrosine-protein phosphatase non-receptor type 2 (TC-PTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 48481.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P17706 |
|---|
| Residue: | 415 |
|---|
| Sequence: | MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
|
|
|
|---|
| BDBM50142324 |
|---|
| n/a |
|---|
| Name | BDBM50142324 |
|---|
| Synonyms: | ({4-[2-Benzotriazol-1-yl-3-[4-(difluoro-phosphono-methyl)-phenyl]-2-(1H-tetrazol-5-yl)-propyl]-phenyl}-difluoro-methyl)-phosphonic acid | CHEMBL418703 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21F4N7O6P2 |
|---|
| Mol. Mass. | 641.408 |
|---|
| SMILES | OP(O)(=O)C(F)(F)c1ccc(CC(Cc2ccc(cc2)C(F)(F)P(O)(O)=O)(c2nnn[nH]2)n2nnc3ccccc23)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
