| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50144268 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_147341 |
|---|
| Ki | 20±n/a nM |
|---|
| Citation |  Carson, JR; Coats, SJ; Codd, EE; Dax, SL; Lee, J; Martinez, RP; McKown, LA; Anne Neilson, L; Pitis, PM; Wu, WN; Zhang, SP N-alkyl-4-[(8-azabicyclo[3.2.1]-oct-3-ylidene)phenylmethyl]benzamides, micro and delta opioid agonists: a micro address. Bioorg Med Chem Lett14:2113-6 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50144268 |
|---|
| n/a |
|---|
| Name | BDBM50144268 |
|---|
| Synonyms: | CHEMBL307973 | N-Cyclopropyl-4-[(8-phenethyl-8-aza-bicyclo[3.2.1]oct-3-ylidene)-phenyl-methyl]-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H34N2O |
|---|
| Mol. Mass. | 462.6252 |
|---|
| SMILES | O=[#6](-[#7]-[#6]-1-[#6]-[#6]-1)-c1ccc(cc1)-[#6](=[#6]-1/[#6]-[#6]-2-[#6]-[#6]-[#6](-[#6]-1)-[#7]-2-[#6]-[#6]-c1ccccc1)\c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
