Reaction Details |
| Report a problem with these data |
Target | Fibroblast growth factor 1 |
---|
Ligand | BDBM50144524 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_70464 |
---|
Kd | 10000±n/a nM |
---|
Citation | Liu, L; Ping Li, C; Cochran, S; Ferro, V Application of the four-component Ugi condensation for the preparation of sulfated glycoconjugate libraries. Bioorg Med Chem Lett14:2221-6 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fibroblast growth factor 1 |
---|
Name: | Fibroblast growth factor 1 |
Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
Type: | Protein |
Mol. Mass.: | 17461.01 |
Organism: | Homo sapiens (Human) |
Description: | P05230 |
Residue: | 155 |
Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
BDBM50144524 |
---|
n/a |
---|
Name | BDBM50144524 |
Synonyms: | CHEMBL3215307 | Sodium sulfated glycoconjugate derivative |
Type | Small organic molecule |
Emp. Form. | C39H60N4Na8O40S8 |
Mol. Mass. | 1665.335 |
SMILES | [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].CC(C)(CC(=O)N(CCO[C@H]1O[C@@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@H]1OS([O-])(=O)=O)CC(=O)NC1CCCCC1)CC(=O)N(CCO[C@H]1O[C@@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@H]1OS([O-])(=O)=O)CC(=O)NC1CCCCC1 |r| |
Structure |
|