| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 1 |
|---|
| Ligand | BDBM50144526 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_70464 |
|---|
| Kd | 4840±n/a nM |
|---|
| Citation |  Liu, L; Ping Li, C; Cochran, S; Ferro, V Application of the four-component Ugi condensation for the preparation of sulfated glycoconjugate libraries. Bioorg Med Chem Lett14:2221-6 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fibroblast growth factor 1 |
|---|
| Name: | Fibroblast growth factor 1 |
|---|
| Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17461.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05230 |
|---|
| Residue: | 155 |
|---|
| Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
|---|
| BDBM50144526 |
|---|
| n/a |
|---|
| Name | BDBM50144526 |
|---|
| Synonyms: | CHEMBL3215304 | Sodium sulfated glycoconjugate derivative |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H33N2Na7O35S7 |
|---|
| Mol. Mass. | 1318.916 |
|---|
| SMILES | [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].CO[C@H]1O[C@@H](COCC(=O)N(CC(=O)NCCO[C@H]2O[C@@H](COS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@H]2OS([O-])(=O)=O)Cc2ccccc2)[C@@H](OS([O-])(=O)=O)[C@H](OS([O-])(=O)=O)[C@H]1OS([O-])(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
