Reaction Details |
| Report a problem with these data |
Target | Fibroblast growth factor 2 |
---|
Ligand | BDBM50144520 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_70634 (CHEMBL678690) |
---|
Kd | >800000±n/a nM |
---|
Citation | Liu, L; Ping Li, C; Cochran, S; Ferro, V Application of the four-component Ugi condensation for the preparation of sulfated glycoconjugate libraries. Bioorg Med Chem Lett14:2221-6 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fibroblast growth factor 2 |
---|
Name: | Fibroblast growth factor 2 |
Synonyms: | Basic fibroblast growth factor | FGF-2 | FGF2 | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (bFGF) | Fibroblast growth factor receptor 2 (FGF-2) | HBGF-2 | Heparin-binding growth factor 2 |
Type: | Protein |
Mol. Mass.: | 30803.89 |
Organism: | Homo sapiens (Human) |
Description: | P09038 |
Residue: | 288 |
Sequence: | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
|
|
BDBM50144520 |
---|
n/a |
---|
Name | BDBM50144520 |
Synonyms: | CHEMBL308715 | Sodium sulfated glycoconjugate derivative |
Type | Small organic molecule |
Emp. Form. | C27H30N2O19S4 |
Mol. Mass. | 814.791 |
SMILES | [O-]S(=O)(=O)OC1OC(C(OS([O-])(=O)=O)C(OS([O-])(=O)=O)C1OS([O-])(=O)=O)C(=O)N(Cc1ccccc1)C(C(=O)NC1CCCCC1)c1ccccc1 |
Structure |
|