| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2C |
|---|
| Ligand | BDBM10755 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_2970 |
|---|
| EC50 | 1.7±n/a nM |
|---|
| Citation |  Bentley, JM; Adams, DR; Bebbington, D; Benwell, KR; Bickerdike, MJ; Davidson, JE; Dawson, CE; Dourish, CT; Duncton, MA; Gaur, S; George, AR; Giles, PR; Hamlyn, RJ; Kennett, GA; Knight, AR; Malcolm, CS; Mansell, HL; Misra, A; Monck, NJ; Pratt, RM; Quirk, K; Roffey, JR; Vickers, SP; Cliffe, IA Indoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett14:2367-70 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2C |
|---|
| Name: | 5-hydroxytryptamine receptor 2C |
|---|
| Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 51836.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28335 |
|---|
| Residue: | 458 |
|---|
| Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
|---|
| BDBM10755 |
|---|
| n/a |
|---|
| Name | BDBM10755 |
|---|
| Synonyms: | 14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H12N2O |
|---|
| Mol. Mass. | 176.2151 |
|---|
| SMILES | NCCc1c[nH]c2ccc(O)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
