Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50145029 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_200962 (CHEMBL802050) |
---|
Ki | 0.22±n/a nM |
---|
Citation | Berardi, F; Ferorelli, S; Abate, C; Colabufo, NA; Contino, M; Perrone, R; Tortorella, V 4-(tetralin-1-yl)- and 4-(naphthalen-1-yl)alkyl derivatives of 1-cyclohexylpiperazine as sigma receptor ligands with agonist sigma2 activity. J Med Chem47:2308-17 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50145029 |
---|
n/a |
---|
Name | BDBM50145029 |
Synonyms: | 1-Cyclohexyl-4-(4-naphthalen-1-yl-butyl)-piperazine | CHEMBL306133 |
Type | Small organic molecule |
Emp. Form. | C24H34N2 |
Mol. Mass. | 350.5402 |
SMILES | C(CCc1cccc2ccccc12)CN1CCN(CC1)C1CCCCC1 |
Structure |
|