Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50145795 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54948 (CHEMBL669019) |
---|
IC50 | 1100±n/a nM |
---|
Citation | Rosowsky, A; Fu, H; Chan, DC; Queener, SF Synthesis of 2,4-diamino-6-[2'-O-(omega-carboxyalkyl)oxydibenz[b,f]azepin-5-yl]methylpteridines as potent and selective inhibitors of Pneumocystis carinii, Toxoplasma gondii, and Mycobacterium avium dihydrofolate reductase. J Med Chem47:2475-85 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50145795 |
---|
n/a |
---|
Name | BDBM50145795 |
Synonyms: | 3-[5-(2,4-Diamino-pteridin-6-ylmethyl)-5H-dibenzo[b,f]azepin-2-yloxy]-propionic acid | CHEMBL84273 |
Type | Small organic molecule |
Emp. Form. | C24H21N7O3 |
Mol. Mass. | 455.4686 |
SMILES | Nc1nc(N)c2nc(CN3c4ccccc4C=Cc4cc(OCCC(O)=O)ccc34)cnc2n1 |c:17| |
Structure |
|