| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hepatitis A virus cellular receptor 2 |
|---|
| Ligand | BDBM50579448 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2135392 (CHEMBL4845002) |
|---|
| Ki | 1800±n/a nM |
|---|
| Citation |  Rietz, TA; Teuscher, KB; Mills, JJ; Gogliotti, RD; Lepovitz, LT; Scaggs, WR; Yoshida, K; Luong, K; Lee, T; Fesik, SW Fragment-Based Discovery of Small Molecules Bound to T-Cell Immunoglobulin and Mucin Domain-Containing Molecule 3 (TIM-3). J Med Chem64:14757-14772 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hepatitis A virus cellular receptor 2 |
|---|
| Name: | Hepatitis A virus cellular receptor 2 |
|---|
| Synonyms: | CD_antigen=CD366 | HAVCR2 | HAVR2_HUMAN | HAVcr-2 | Hepatitis A virus cellular receptor 2 | T-cell immunoglobulin and mucin domain-containing protein 3 | T-cell immunoglobulin mucin receptor 3 | T-cell membrane protein 3 | TIM-3 | TIM3 | TIMD-3 | TIMD3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33391.41 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_119972 |
|---|
| Residue: | 301 |
|---|
| Sequence: | MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
P
|
|
|
|---|
| BDBM50579448 |
|---|
| n/a |
|---|
| Name | BDBM50579448 |
|---|
| Synonyms: | CHEMBL4851756 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H12ClN5O |
|---|
| Mol. Mass. | 349.774 |
|---|
| SMILES | Cc1nc2c3cc(c(Cl)cc3[nH]c(=O)n2n1)-c1cccc2[nH]ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
