Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50147095 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_213066 |
---|
Ki | 3±n/a nM |
---|
Citation | Wendt, MD; Geyer, A; McClellan, WJ; Rockway, TW; Weitzberg, M; Zhao, X; Mantei, R; Stewart, K; Nienaber, V; Klinghofer, V; Giranda, VL Interaction with the S1 beta-pocket of urokinase: 8-heterocycle substituted and 6,8-disubstituted 2-naphthamidine urokinase inhibitors. Bioorg Med Chem Lett14:3063-8 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM50147095 |
---|
n/a |
---|
Name | BDBM50147095 |
Synonyms: | 6-Carbamimidoyl-4-(5-ethanesulfonyl-furan-3-yl)-naphthalene-2-carboxylic acid (3-cyclopentyloxy-phenyl)-amide | CHEMBL320233 |
Type | Small organic molecule |
Emp. Form. | C29H29N3O5S |
Mol. Mass. | 531.623 |
SMILES | CCS(=O)(=O)c1cc(co1)-c1cc(cc2ccc(cc12)C(N)=N)C(=O)Nc1cccc(OC2CCCC2)c1 |
Structure |
|